Anti SHISA7 pAb (ATL-HPA058935)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058935-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SHISA7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053550: 97%, ENSRNOG00000016877: 97%
Entrez Gene ID: 729956
Uniprot ID: A6NL88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VGAKVAFSKASRAPRAHRDINVPRALVDILRHQA |
| Gene Sequence | VGAKVAFSKASRAPRAHRDINVPRALVDILRHQA |
| Gene ID - Mouse | ENSMUSG00000053550 |
| Gene ID - Rat | ENSRNOG00000016877 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SHISA7 pAb (ATL-HPA058935) | |
| Datasheet | Anti SHISA7 pAb (ATL-HPA058935) Datasheet (External Link) |
| Vendor Page | Anti SHISA7 pAb (ATL-HPA058935) at Atlas Antibodies |
| Documents & Links for Anti SHISA7 pAb (ATL-HPA058935) | |
| Datasheet | Anti SHISA7 pAb (ATL-HPA058935) Datasheet (External Link) |
| Vendor Page | Anti SHISA7 pAb (ATL-HPA058935) |