Anti SHISA4 pAb (ATL-HPA061273)

Atlas Antibodies

Catalog No.:
ATL-HPA061273-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: shisa family member 4
Gene Name: SHISA4
Alternative Gene Name: C1orf40, hShisa4, TMEM58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041889: 96%, ENSRNOG00000007369: 96%
Entrez Gene ID: 149345
Uniprot ID: Q96DD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DCLWYLDRNGSWHPGFNCEFFTFCCGTCYHRYCCRDLTLLITERQQKHCL
Gene Sequence DCLWYLDRNGSWHPGFNCEFFTFCCGTCYHRYCCRDLTLLITERQQKHCL
Gene ID - Mouse ENSMUSG00000041889
Gene ID - Rat ENSRNOG00000007369
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SHISA4 pAb (ATL-HPA061273)
Datasheet Anti SHISA4 pAb (ATL-HPA061273) Datasheet (External Link)
Vendor Page Anti SHISA4 pAb (ATL-HPA061273) at Atlas Antibodies

Documents & Links for Anti SHISA4 pAb (ATL-HPA061273)
Datasheet Anti SHISA4 pAb (ATL-HPA061273) Datasheet (External Link)
Vendor Page Anti SHISA4 pAb (ATL-HPA061273)