Anti SHC4 pAb (ATL-HPA074146)

Atlas Antibodies

Catalog No.:
ATL-HPA074146-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SHC (Src homology 2 domain containing) family, member 4
Gene Name: SHC4
Alternative Gene Name: RaLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035109: 75%, ENSRNOG00000037134: 75%
Entrez Gene ID: 399694
Uniprot ID: Q6S5L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSS
Gene Sequence SQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSS
Gene ID - Mouse ENSMUSG00000035109
Gene ID - Rat ENSRNOG00000037134
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SHC4 pAb (ATL-HPA074146)
Datasheet Anti SHC4 pAb (ATL-HPA074146) Datasheet (External Link)
Vendor Page Anti SHC4 pAb (ATL-HPA074146) at Atlas Antibodies

Documents & Links for Anti SHC4 pAb (ATL-HPA074146)
Datasheet Anti SHC4 pAb (ATL-HPA074146) Datasheet (External Link)
Vendor Page Anti SHC4 pAb (ATL-HPA074146)