Anti SHC3 pAb (ATL-HPA072448)

Atlas Antibodies

Catalog No.: ATL-HPA072448-25

Protein Description: SHC (Src homology 2 domain containing) transforming protein 3
Gene Name: SHC3
Alternative Gene Name: N-Shc, NSHC, SHCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021448: 89%, ENSRNOG00000014366: 92%
Entrez Gene ID: 53358
Uniprot ID: Q92529
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSD
• Gene Sequence: LRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSD
• Gene ID - Mouse: ENSMUSG00000021448
• Gene ID - Rat: ENSRNOG00000014366
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.