Anti SHC3 pAb (ATL-HPA072448)

Atlas Antibodies

Catalog No.:
ATL-HPA072448-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SHC (Src homology 2 domain containing) transforming protein 3
Gene Name: SHC3
Alternative Gene Name: N-Shc, NSHC, SHCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021448: 89%, ENSRNOG00000014366: 92%
Entrez Gene ID: 53358
Uniprot ID: Q92529
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSD
Gene Sequence LRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSD
Gene ID - Mouse ENSMUSG00000021448
Gene ID - Rat ENSRNOG00000014366
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SHC3 pAb (ATL-HPA072448)
Datasheet Anti SHC3 pAb (ATL-HPA072448) Datasheet (External Link)
Vendor Page Anti SHC3 pAb (ATL-HPA072448) at Atlas Antibodies

Documents & Links for Anti SHC3 pAb (ATL-HPA072448)
Datasheet Anti SHC3 pAb (ATL-HPA072448) Datasheet (External Link)
Vendor Page Anti SHC3 pAb (ATL-HPA072448)