Anti SH3RF2 pAb (ATL-HPA058119)

Atlas Antibodies

SKU:
ATL-HPA058119-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SH3 domain containing ring finger 2
Gene Name: SH3RF2
Alternative Gene Name: FLJ23654, Hepp1, POSHER, PPP1R39, RNF158
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057719: 76%, ENSRNOG00000018780: 74%
Entrez Gene ID: 153769
Uniprot ID: Q8TEC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGSLRKGRSSMRKNGSLQRPLQSGIPTLVVGSLRRSPTMVLRPQQFQFYQPQGIPSSPSAVVVEMGSKPALTGEPALTCISRGSE
Gene Sequence QGSLRKGRSSMRKNGSLQRPLQSGIPTLVVGSLRRSPTMVLRPQQFQFYQPQGIPSSPSAVVVEMGSKPALTGEPALTCISRGSE
Gene ID - Mouse ENSMUSG00000057719
Gene ID - Rat ENSRNOG00000018780
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SH3RF2 pAb (ATL-HPA058119)
Datasheet Anti SH3RF2 pAb (ATL-HPA058119) Datasheet (External Link)
Vendor Page Anti SH3RF2 pAb (ATL-HPA058119) at Atlas Antibodies

Documents & Links for Anti SH3RF2 pAb (ATL-HPA058119)
Datasheet Anti SH3RF2 pAb (ATL-HPA058119) Datasheet (External Link)
Vendor Page Anti SH3RF2 pAb (ATL-HPA058119)