Anti SH3RF1 pAb (ATL-HPA074783)

Atlas Antibodies

Catalog No.:
ATL-HPA074783-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SH3 domain containing ring finger 1
Gene Name: SH3RF1
Alternative Gene Name: KIAA1494, POSH, RNF142, SH3MD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031642: 91%, ENSRNOG00000010358: 94%
Entrez Gene ID: 57630
Uniprot ID: Q7Z6J0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVTNASQAKVPMSTAGQTSRGVTMVSPSTAGGPAQKLQGNGVAGSPSVVPAAVVSAAHIQTSPQAKVLLH
Gene Sequence AVTNASQAKVPMSTAGQTSRGVTMVSPSTAGGPAQKLQGNGVAGSPSVVPAAVVSAAHIQTSPQAKVLLH
Gene ID - Mouse ENSMUSG00000031642
Gene ID - Rat ENSRNOG00000010358
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SH3RF1 pAb (ATL-HPA074783)
Datasheet Anti SH3RF1 pAb (ATL-HPA074783) Datasheet (External Link)
Vendor Page Anti SH3RF1 pAb (ATL-HPA074783) at Atlas Antibodies

Documents & Links for Anti SH3RF1 pAb (ATL-HPA074783)
Datasheet Anti SH3RF1 pAb (ATL-HPA074783) Datasheet (External Link)
Vendor Page Anti SH3RF1 pAb (ATL-HPA074783)