Anti SH3PXD2B pAb (ATL-HPA036471 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036471-25

Protein Description: SH3 and PX domains 2B
Gene Name: SH3PXD2B
Alternative Gene Name: FLJ20831, KIAA1295
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040711: 78%, ENSRNOG00000004063: 80%
Entrez Gene ID: 285590
Uniprot ID: A1X283
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPGVILPMMPAKHIPPARDSRRPEPKPDKSRLFQLKNDMGLECGHKVLAKEVKKPNLRPISKSKTDLPEEKPDATPQNPFLKSRPQV
• Gene Sequence: PPGVILPMMPAKHIPPARDSRRPEPKPDKSRLFQLKNDMGLECGHKVLAKEVKKPNLRPISKSKTDLPEEKPDATPQNPFLKSRPQV
• Gene ID - Mouse: ENSMUSG00000040711
• Gene ID - Rat: ENSRNOG00000004063
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SH3PXD2B pAb (ATL-HPA036471 w/enhanced validation) – 3 Found

Wilson, Gabrielle R; Sunley, Jasmine; Smith, Katherine R; Pope, Kate; Bromhead, Catherine J; Fitzpatrick, Elizabeth; Di Rocco, Maja; van Steensel, Maurice; Coman, David J; Leventer, Richard J; Delatycki, Martin B; Amor, David J; Bahlo, Melanie; Lockhart, Paul J. Mutations in SH3PXD2B cause Borrone dermato-cardio-skeletal syndrome. European Journal Of Human Genetics : Ejhg. 2014;22(6):741-7. 

Marsh, Ashley P L; Lukic, Vesna; Pope, Kate; Bromhead, Catherine; Tankard, Rick; Ryan, Monique M; Yiu, Eppie M; Sim, Joe C H; Delatycki, Martin B; Amor, David J; McGillivray, George; Sherr, Elliott H; Bahlo, Melanie; Leventer, Richard J; Lockhart, Paul J. Complete callosal agenesis, pontocerebellar hypoplasia, and axonal neuropathy due to AMPD2 loss. Neurology. Genetics. 2015;1(2):e16. 

László, Loretta; Maczelka, Hédi; Takács, Tamás; Kurilla, Anita; Tilajka, Álmos; Buday, László; Vas, Virag; Apáti, Ágota. A Novel Cell-Based Model for a Rare Disease: The Tks4-KO Human Embryonic Stem Cell Line as a Frank-Ter Haar Syndrome Model System. International Journal Of Molecular Sciences. 2022;23(15)