Anti SH3GL2 pAb (ATL-HPA026685 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026685-25

Protein Description: SH3-domain GRB2-like 2
Gene Name: SH3GL2
Alternative Gene Name: CNSA2, EEN-B1, SH3D2A, SH3P4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028488: 98%, ENSRNOG00000006761: 97%
Entrez Gene ID: 6456
Uniprot ID: Q99962
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYDFEPENEGELG
• Gene Sequence: ALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYDFEPENEGELG
• Gene ID - Mouse: ENSMUSG00000028488
• Gene ID - Rat: ENSRNOG00000006761
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.