Anti SH3D19 pAb (ATL-HPA058562)

Atlas Antibodies

SKU:
ATL-HPA058562-25
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SH3 domain containing 19
Gene Name: SH3D19
Alternative Gene Name: DKFZp434D0215, EBP, EVE1, Kryn, SH3P19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028082: 82%, ENSRNOG00000011752: 84%
Entrez Gene ID: 152503
Uniprot ID: Q5HYK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAEESVGSEMVLDPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLPAEKPIGNTFSTVSGKLSN
Gene Sequence LAEESVGSEMVLDPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLPAEKPIGNTFSTVSGKLSN
Gene ID - Mouse ENSMUSG00000028082
Gene ID - Rat ENSRNOG00000011752
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SH3D19 pAb (ATL-HPA058562)
Datasheet Anti SH3D19 pAb (ATL-HPA058562) Datasheet (External Link)
Vendor Page Anti SH3D19 pAb (ATL-HPA058562) at Atlas Antibodies

Documents & Links for Anti SH3D19 pAb (ATL-HPA058562)
Datasheet Anti SH3D19 pAb (ATL-HPA058562) Datasheet (External Link)
Vendor Page Anti SH3D19 pAb (ATL-HPA058562)