Anti SH3D19 pAb (ATL-HPA058562)

Atlas Antibodies

Catalog No.: ATL-HPA058562-25

Protein Description: SH3 domain containing 19
Gene Name: SH3D19
Alternative Gene Name: DKFZp434D0215, EBP, EVE1, Kryn, SH3P19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028082: 82%, ENSRNOG00000011752: 84%
Entrez Gene ID: 152503
Uniprot ID: Q5HYK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAEESVGSEMVLDPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLPAEKPIGNTFSTVSGKLSN
• Gene Sequence: LAEESVGSEMVLDPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLPAEKPIGNTFSTVSGKLSN
• Gene ID - Mouse: ENSMUSG00000028082
• Gene ID - Rat: ENSRNOG00000011752
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.