Anti SH3BP5 pAb (ATL-HPA057988)
Atlas Antibodies
- SKU:
- ATL-HPA057988-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SH3BP5
Alternative Gene Name: Sab
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021892: 89%, ENSRNOG00000052391: 89%
Entrez Gene ID: 9467
Uniprot ID: O60239
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPDAISVASEAFEDDSCSNFVSE |
Gene Sequence | ELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPDAISVASEAFEDDSCSNFVSE |
Gene ID - Mouse | ENSMUSG00000021892 |
Gene ID - Rat | ENSRNOG00000052391 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SH3BP5 pAb (ATL-HPA057988) | |
Datasheet | Anti SH3BP5 pAb (ATL-HPA057988) Datasheet (External Link) |
Vendor Page | Anti SH3BP5 pAb (ATL-HPA057988) at Atlas Antibodies |
Documents & Links for Anti SH3BP5 pAb (ATL-HPA057988) | |
Datasheet | Anti SH3BP5 pAb (ATL-HPA057988) Datasheet (External Link) |
Vendor Page | Anti SH3BP5 pAb (ATL-HPA057988) |
Citations for Anti SH3BP5 pAb (ATL-HPA057988) – 1 Found |
Jenkins, Meredith L; Margaria, Jean Piero; Stariha, Jordan T B; Hoffmann, Reece M; McPhail, Jacob A; Hamelin, David J; Boulanger, Martin J; Hirsch, Emilio; Burke, John E. Structural determinants of Rab11 activation by the guanine nucleotide exchange factor SH3BP5. Nature Communications. 2018;9(1):3772. PubMed |