Anti SH3BP5 pAb (ATL-HPA057988)
Atlas Antibodies
- SKU:
- ATL-HPA057988-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SH3BP5
Alternative Gene Name: Sab
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021892: 89%, ENSRNOG00000052391: 89%
Entrez Gene ID: 9467
Uniprot ID: O60239
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPDAISVASEAFEDDSCSNFVSE |
| Gene Sequence | ELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPDAISVASEAFEDDSCSNFVSE |
| Gene ID - Mouse | ENSMUSG00000021892 |
| Gene ID - Rat | ENSRNOG00000052391 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SH3BP5 pAb (ATL-HPA057988) | |
| Datasheet | Anti SH3BP5 pAb (ATL-HPA057988) Datasheet (External Link) |
| Vendor Page | Anti SH3BP5 pAb (ATL-HPA057988) at Atlas Antibodies |
| Documents & Links for Anti SH3BP5 pAb (ATL-HPA057988) | |
| Datasheet | Anti SH3BP5 pAb (ATL-HPA057988) Datasheet (External Link) |
| Vendor Page | Anti SH3BP5 pAb (ATL-HPA057988) |
| Citations for Anti SH3BP5 pAb (ATL-HPA057988) – 1 Found |
| Jenkins, Meredith L; Margaria, Jean Piero; Stariha, Jordan T B; Hoffmann, Reece M; McPhail, Jacob A; Hamelin, David J; Boulanger, Martin J; Hirsch, Emilio; Burke, John E. Structural determinants of Rab11 activation by the guanine nucleotide exchange factor SH3BP5. Nature Communications. 2018;9(1):3772. PubMed |