Anti SH3BP1 pAb (ATL-HPA000757 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000757-25

Protein Description: SH3-domain binding protein 1
Gene Name: SH3BP1
Alternative Gene Name: ARHGAP43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022436: 75%, ENSRNOG00000009360: 74%
Entrez Gene ID: 23616
Uniprot ID: Q9Y3L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQSADTLFPGDINFNVSGLFSAVTLQDTVSDRLASEELPSTAVPTPATTPAPAPAPAPAPAPALASAATKERTESEVPP
• Gene Sequence: ENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQSADTLFPGDINFNVSGLFSAVTLQDTVSDRLASEELPSTAVPTPATTPAPAPAPAPAPAPALASAATKERTESEVPP
• Gene ID - Mouse: ENSMUSG00000022436
• Gene ID - Rat: ENSRNOG00000009360
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SH3BP1 pAb (ATL-HPA000757 w/enhanced validation) – 1 Found

Liu, Chen-Ying; Yu, Tong; Huang, Yuji; Cui, Long; Hong, Wanjin. ETS (E26 transformation-specific) up-regulation of the transcriptional co-activator TAZ promotes cell migration and metastasis in prostate cancer. The Journal Of Biological Chemistry. 2017;292(22):9420-9430.