Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051248-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SH3BGRL
Alternative Gene Name: MGC117402
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031246: 93%, ENSRNOG00000002280: 98%
Entrez Gene ID: 6451
Uniprot ID: O75368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA |
Gene Sequence | FNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA |
Gene ID - Mouse | ENSMUSG00000031246 |
Gene ID - Rat | ENSRNOG00000002280 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation) | |
Datasheet | Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation) | |
Datasheet | Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation) |
Citations for Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation) – 1 Found |
Zhang, Shaoyang; Liu, Xiufeng; Abdulmomen Ali Mohammed, Saleh; Li, Hui; Cai, Wanhua; Guan, Wen; Liu, Daiyun; Wei, Yanli; Rong, Dade; Fang, Ying; Haider, Farhan; Lv, Haimei; Jin, Ziwei; Chen, Xiaomin; Mo, Zhuomao; Li, Lujie; Yang, Shulan; Wang, Haihe. Adaptor SH3BGRL drives autophagy-mediated chemoresistance through promoting PIK3C3 translation and ATG12 stability in breast cancers. Autophagy. 2022;18(8):1822-1840. PubMed |