Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA051248-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SH3 domain binding glutamate-rich protein like
Gene Name: SH3BGRL
Alternative Gene Name: MGC117402
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031246: 93%, ENSRNOG00000002280: 98%
Entrez Gene ID: 6451
Uniprot ID: O75368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
Gene Sequence FNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
Gene ID - Mouse ENSMUSG00000031246
Gene ID - Rat ENSRNOG00000002280
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation)
Datasheet Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation)
Datasheet Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation)
Citations for Anti SH3BGRL pAb (ATL-HPA051248 w/enhanced validation) – 1 Found
Zhang, Shaoyang; Liu, Xiufeng; Abdulmomen Ali Mohammed, Saleh; Li, Hui; Cai, Wanhua; Guan, Wen; Liu, Daiyun; Wei, Yanli; Rong, Dade; Fang, Ying; Haider, Farhan; Lv, Haimei; Jin, Ziwei; Chen, Xiaomin; Mo, Zhuomao; Li, Lujie; Yang, Shulan; Wang, Haihe. Adaptor SH3BGRL drives autophagy-mediated chemoresistance through promoting PIK3C3 translation and ATG12 stability in breast cancers. Autophagy. 2022;18(8):1822-1840.  PubMed