Anti SH2D4A pAb (ATL-HPA001919 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA001919-100
Immunohistochemistry analysis in human urinary bladder and testis tissues using Anti-SH2D4A antibody. Corresponding SH2D4A RNA-seq data are presented for the same tissues.
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human cell line A-431<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: SH2 domain containing 4A
Gene Name: SH2D4A
Alternative Gene Name: FLJ20967, PPP1R38, SH2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053886: 93%, ENSRNOG00000013541: 93%
Entrez Gene ID: 63898
Uniprot ID: Q9H788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen KEEQLPLRAGYQKTSDTIAPWFHGILTLKKANELLLSTGMPGSFLIRVSERIKGYALSYLSEDGCKHFLIDASADAYSFLGVDQLQHATLADLVEYHKEEPITSLGKELLLYPCGQQ
Gene Sequence KEEQLPLRAGYQKTSDTIAPWFHGILTLKKANELLLSTGMPGSFLIRVSERIKGYALSYLSEDGCKHFLIDASADAYSFLGVDQLQHATLADLVEYHKEEPITSLGKELLLYPCGQQ
Gene ID - Mouse ENSMUSG00000053886
Gene ID - Rat ENSRNOG00000013541
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SH2D4A pAb (ATL-HPA001919 w/enhanced validation)
Datasheet Anti SH2D4A pAb (ATL-HPA001919 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SH2D4A pAb (ATL-HPA001919 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SH2D4A pAb (ATL-HPA001919 w/enhanced validation)
Datasheet Anti SH2D4A pAb (ATL-HPA001919 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SH2D4A pAb (ATL-HPA001919 w/enhanced validation)
Citations for Anti SH2D4A pAb (ATL-HPA001919 w/enhanced validation) – 1 Found
Matsumoto, Takuro; Okayama, Hirokazu; Nakajima, Shotaro; Saito, Katsuharu; Ito, Misato; Kaneta, Akinao; Kanke, Yasuyuki; Onozawa, Hisashi; Hayase, Suguru; Fujita, Shotaro; Sakamoto, Wataru; Saito, Motonobu; Seze, Zenichiro; Momma, Tomoyuki; Mimura, Kosaku; Kono, Koji. SH2D4A downregulation due to loss of chromosome 8p is associated with poor prognosis and low T cell infiltration in colorectal cancer. British Journal Of Cancer. 2022;126(6):917-926.  PubMed
!