Anti SH2D3C pAb (ATL-HPA047586 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA047586-25
  • Immunohistochemistry analysis in human spleen and pancreas tissues using Anti-SH2D3C antibody. Corresponding SH2D3C RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SH2 domain containing 3C
Gene Name: SH2D3C
Alternative Gene Name: NSP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059013: 90%, ENSRNOG00000054560: 91%
Entrez Gene ID: 10044
Uniprot ID: Q8N5H7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGAIIYCPVNRTFPLRYLEASYGLGQGSSKPASPVSPSGPKGSHMKRRSVTMTDGLTADKVTRSDGCPTSTSLPRPRDSIRSCALSMDQIPDLH
Gene Sequence SGAIIYCPVNRTFPLRYLEASYGLGQGSSKPASPVSPSGPKGSHMKRRSVTMTDGLTADKVTRSDGCPTSTSLPRPRDSIRSCALSMDQIPDLH
Gene ID - Mouse ENSMUSG00000059013
Gene ID - Rat ENSRNOG00000054560
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SH2D3C pAb (ATL-HPA047586 w/enhanced validation)
Datasheet Anti SH2D3C pAb (ATL-HPA047586 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SH2D3C pAb (ATL-HPA047586 w/enhanced validation)