Anti SH2D3A pAb (ATL-HPA064382)

Atlas Antibodies

SKU:
ATL-HPA064382-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & microtubules.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SH2 domain containing 3A
Gene Name: SH2D3A
Alternative Gene Name: NSP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028121: 33%, ENSRNOG00000054560: 32%
Entrez Gene ID: 10045
Uniprot ID: Q9BRG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WRQLRRSHTEAALAFEQELKPLMRALDEGAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPN
Gene Sequence WRQLRRSHTEAALAFEQELKPLMRALDEGAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPN
Gene ID - Mouse ENSMUSG00000028121
Gene ID - Rat ENSRNOG00000054560
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SH2D3A pAb (ATL-HPA064382)
Datasheet Anti SH2D3A pAb (ATL-HPA064382) Datasheet (External Link)
Vendor Page Anti SH2D3A pAb (ATL-HPA064382) at Atlas Antibodies

Documents & Links for Anti SH2D3A pAb (ATL-HPA064382)
Datasheet Anti SH2D3A pAb (ATL-HPA064382) Datasheet (External Link)
Vendor Page Anti SH2D3A pAb (ATL-HPA064382)