Anti SH2B2 pAb (ATL-HPA051131)

Atlas Antibodies

Catalog No.: ATL-HPA051131-25

Protein Description: SH2B adaptor protein 2
Gene Name: SH2B2
Alternative Gene Name: APS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005057: 97%, ENSRNOG00000001425: 97%
Entrez Gene ID: 10603
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD
• Gene Sequence: RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD
• Gene ID - Mouse: ENSMUSG00000005057
• Gene ID - Rat: ENSRNOG00000001425
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.