Anti SH2B2 pAb (ATL-HPA051131)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051131-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SH2B2
Alternative Gene Name: APS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005057: 97%, ENSRNOG00000001425: 97%
Entrez Gene ID: 10603
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD |
| Gene Sequence | RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD |
| Gene ID - Mouse | ENSMUSG00000005057 |
| Gene ID - Rat | ENSRNOG00000001425 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SH2B2 pAb (ATL-HPA051131) | |
| Datasheet | Anti SH2B2 pAb (ATL-HPA051131) Datasheet (External Link) |
| Vendor Page | Anti SH2B2 pAb (ATL-HPA051131) at Atlas Antibodies |
| Documents & Links for Anti SH2B2 pAb (ATL-HPA051131) | |
| Datasheet | Anti SH2B2 pAb (ATL-HPA051131) Datasheet (External Link) |
| Vendor Page | Anti SH2B2 pAb (ATL-HPA051131) |