Anti SH2B1 pAb (ATL-HPA076175)

Atlas Antibodies

Catalog No.:
ATL-HPA076175-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SH2B adaptor protein 1
Gene Name: SH2B1
Alternative Gene Name: FLJ30542, SH2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030733: 93%, ENSRNOG00000049181: 91%
Entrez Gene ID: 25970
Uniprot ID: Q9NRF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLGGNSNSNSSGGAGTVGRGLVSDGTSPGERWTHRFERLRLSRGGGALKDGAGMVQREELLSFMGAEEAAPDPAGV
Gene Sequence VLGGNSNSNSSGGAGTVGRGLVSDGTSPGERWTHRFERLRLSRGGGALKDGAGMVQREELLSFMGAEEAAPDPAGV
Gene ID - Mouse ENSMUSG00000030733
Gene ID - Rat ENSRNOG00000049181
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SH2B1 pAb (ATL-HPA076175)
Datasheet Anti SH2B1 pAb (ATL-HPA076175) Datasheet (External Link)
Vendor Page Anti SH2B1 pAb (ATL-HPA076175) at Atlas Antibodies

Documents & Links for Anti SH2B1 pAb (ATL-HPA076175)
Datasheet Anti SH2B1 pAb (ATL-HPA076175) Datasheet (External Link)
Vendor Page Anti SH2B1 pAb (ATL-HPA076175)