Anti SH2B1 pAb (ATL-HPA060663)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060663-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SH2B1
Alternative Gene Name: FLJ30542, SH2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030733: 91%, ENSRNOG00000049181: 91%
Entrez Gene ID: 25970
Uniprot ID: Q9NRF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | REFCESHARAAALDFARRFRLYLASHPQYAGPGAEAAFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGAEIS |
| Gene Sequence | REFCESHARAAALDFARRFRLYLASHPQYAGPGAEAAFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGAEIS |
| Gene ID - Mouse | ENSMUSG00000030733 |
| Gene ID - Rat | ENSRNOG00000049181 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SH2B1 pAb (ATL-HPA060663) | |
| Datasheet | Anti SH2B1 pAb (ATL-HPA060663) Datasheet (External Link) |
| Vendor Page | Anti SH2B1 pAb (ATL-HPA060663) at Atlas Antibodies |
| Documents & Links for Anti SH2B1 pAb (ATL-HPA060663) | |
| Datasheet | Anti SH2B1 pAb (ATL-HPA060663) Datasheet (External Link) |
| Vendor Page | Anti SH2B1 pAb (ATL-HPA060663) |