Anti SGSH pAb (ATL-HPA023451 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023451-25

Protein Description: N-sulfoglucosamine sulfohydrolase
Gene Name: SGSH
Alternative Gene Name: HSS, MPS3A, SFMD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005043: 81%, ENSRNOG00000049552: 79%
Entrez Gene ID: 6448
Uniprot ID: P51688
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQ
• Gene Sequence: PTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQ
• Gene ID - Mouse: ENSMUSG00000005043
• Gene ID - Rat: ENSRNOG00000049552
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.