Anti SGSH pAb (ATL-HPA023451 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA023451-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: N-sulfoglucosamine sulfohydrolase
Gene Name: SGSH
Alternative Gene Name: HSS, MPS3A, SFMD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005043: 81%, ENSRNOG00000049552: 79%
Entrez Gene ID: 6448
Uniprot ID: P51688
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQ
Gene Sequence PTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQ
Gene ID - Mouse ENSMUSG00000005043
Gene ID - Rat ENSRNOG00000049552
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SGSH pAb (ATL-HPA023451 w/enhanced validation)
Datasheet Anti SGSH pAb (ATL-HPA023451 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SGSH pAb (ATL-HPA023451 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SGSH pAb (ATL-HPA023451 w/enhanced validation)
Datasheet Anti SGSH pAb (ATL-HPA023451 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SGSH pAb (ATL-HPA023451 w/enhanced validation)