Anti SGO1 pAb (ATL-HPA069302)

Atlas Antibodies

Catalog No.:
ATL-HPA069302-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: shugoshin 1
Gene Name: SGO1
Alternative Gene Name: NY-BR-85, SGOL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023940: 38%, ENSRNOG00000022499: 43%
Entrez Gene ID: 151648
Uniprot ID: Q5FBB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKSTDNVLPRTVSVRSSLKKHCNSICQF
Gene Sequence SGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKSTDNVLPRTVSVRSSLKKHCNSICQF
Gene ID - Mouse ENSMUSG00000023940
Gene ID - Rat ENSRNOG00000022499
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SGO1 pAb (ATL-HPA069302)
Datasheet Anti SGO1 pAb (ATL-HPA069302) Datasheet (External Link)
Vendor Page Anti SGO1 pAb (ATL-HPA069302) at Atlas Antibodies

Documents & Links for Anti SGO1 pAb (ATL-HPA069302)
Datasheet Anti SGO1 pAb (ATL-HPA069302) Datasheet (External Link)
Vendor Page Anti SGO1 pAb (ATL-HPA069302)