Anti SGMS2 pAb (ATL-HPA015076 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015076-25

Protein Description: sphingomyelin synthase 2
Gene Name: SGMS2
Alternative Gene Name: MGC26963, SMS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050931: 73%, ENSRNOG00000011284: 73%
Entrez Gene ID: 166929
Uniprot ID: Q8NHU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESR
• Gene Sequence: IIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESR
• Gene ID - Mouse: ENSMUSG00000050931
• Gene ID - Rat: ENSRNOG00000011284
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.