Anti SGK1 pAb (ATL-HPA051251)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051251-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: SGK1
Alternative Gene Name: SGK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019970: 98%, ENSRNOG00000011815: 98%
Entrez Gene ID: 6446
Uniprot ID: O00141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSL |
Gene Sequence | NILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSL |
Gene ID - Mouse | ENSMUSG00000019970 |
Gene ID - Rat | ENSRNOG00000011815 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SGK1 pAb (ATL-HPA051251) | |
Datasheet | Anti SGK1 pAb (ATL-HPA051251) Datasheet (External Link) |
Vendor Page | Anti SGK1 pAb (ATL-HPA051251) at Atlas Antibodies |
Documents & Links for Anti SGK1 pAb (ATL-HPA051251) | |
Datasheet | Anti SGK1 pAb (ATL-HPA051251) Datasheet (External Link) |
Vendor Page | Anti SGK1 pAb (ATL-HPA051251) |