Anti SGK1 pAb (ATL-HPA051251)

Atlas Antibodies

Catalog No.:
ATL-HPA051251-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: serum/glucocorticoid regulated kinase 1
Gene Name: SGK1
Alternative Gene Name: SGK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019970: 98%, ENSRNOG00000011815: 98%
Entrez Gene ID: 6446
Uniprot ID: O00141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSL
Gene Sequence NILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSL
Gene ID - Mouse ENSMUSG00000019970
Gene ID - Rat ENSRNOG00000011815
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SGK1 pAb (ATL-HPA051251)
Datasheet Anti SGK1 pAb (ATL-HPA051251) Datasheet (External Link)
Vendor Page Anti SGK1 pAb (ATL-HPA051251) at Atlas Antibodies

Documents & Links for Anti SGK1 pAb (ATL-HPA051251)
Datasheet Anti SGK1 pAb (ATL-HPA051251) Datasheet (External Link)
Vendor Page Anti SGK1 pAb (ATL-HPA051251)