Anti SGF29 pAb (ATL-HPA053608)

Atlas Antibodies

Catalog No.:
ATL-HPA053608-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SAGA complex associated factor 29
Gene Name: SGF29
Alternative Gene Name: CCDC101, FLJ32446, TDRD29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030714: 97%, ENSRNOG00000019245: 97%
Entrez Gene ID: 112869
Uniprot ID: Q96ES7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATN
Gene Sequence RGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATN
Gene ID - Mouse ENSMUSG00000030714
Gene ID - Rat ENSRNOG00000019245
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SGF29 pAb (ATL-HPA053608)
Datasheet Anti SGF29 pAb (ATL-HPA053608) Datasheet (External Link)
Vendor Page Anti SGF29 pAb (ATL-HPA053608) at Atlas Antibodies

Documents & Links for Anti SGF29 pAb (ATL-HPA053608)
Datasheet Anti SGF29 pAb (ATL-HPA053608) Datasheet (External Link)
Vendor Page Anti SGF29 pAb (ATL-HPA053608)