Anti SGCZ pAb (ATL-HPA017585)

Atlas Antibodies

Catalog No.: ATL-HPA017585-100

Protein Description: sarcoglycan, zeta
Gene Name: SGCZ
Alternative Gene Name: ZSG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039539: 98%, ENSRNOG00000014603: 57%
Entrez Gene ID: 137868
Uniprot ID: Q96LD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLYVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLTGQLTIGADAVEAQCKRFEVRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDL
• Gene Sequence: PLYVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLTGQLTIGADAVEAQCKRFEVRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDL
• Gene ID - Mouse: ENSMUSG00000039539
• Gene ID - Rat: ENSRNOG00000014603
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SGCZ pAb (ATL-HPA017585) – 1 Found

Yokoi, Fumiaki; Dang, Mai T; Zhou, Tong; Li, Yuqing. Abnormal nuclear envelopes in the striatum and motor deficits in DYT11 myoclonus-dystonia mouse models. Human Molecular Genetics. 2012;21(4):916-25.