Anti SGCE pAb (ATL-HPA074790)

Atlas Antibodies

SKU:
ATL-HPA074790-25
  • Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm, plasma membrane & vesicles.
  • Western blot analysis in human cell line U-138MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: sarcoglycan, epsilon
Gene Name: SGCE
Alternative Gene Name: DYT11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004631: 94%, ENSRNOG00000046905: 96%
Entrez Gene ID: 8910
Uniprot ID: O43556
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DIQLVHHSAIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEIIPPLHTDNYDSTNMPLMQTQQNLPHQTQIPQQQTTGKWY
Gene Sequence DIQLVHHSAIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEIIPPLHTDNYDSTNMPLMQTQQNLPHQTQIPQQQTTGKWY
Gene ID - Mouse ENSMUSG00000004631
Gene ID - Rat ENSRNOG00000046905
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SGCE pAb (ATL-HPA074790)
Datasheet Anti SGCE pAb (ATL-HPA074790) Datasheet (External Link)
Vendor Page Anti SGCE pAb (ATL-HPA074790) at Atlas Antibodies

Documents & Links for Anti SGCE pAb (ATL-HPA074790)
Datasheet Anti SGCE pAb (ATL-HPA074790) Datasheet (External Link)
Vendor Page Anti SGCE pAb (ATL-HPA074790)