Anti SFXN5 pAb (ATL-HPA056866)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056866-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SFXN5
Alternative Gene Name: BBG-TCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033720: 100%, ENSRNOG00000037871: 100%
Entrez Gene ID: 94097
Uniprot ID: Q8TD22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLREAVQLLEDYKHGTLRPGVTNEQLWSAQKIKQAILHPDTNEKIFMPFRMS |
| Gene Sequence | RLREAVQLLEDYKHGTLRPGVTNEQLWSAQKIKQAILHPDTNEKIFMPFRMS |
| Gene ID - Mouse | ENSMUSG00000033720 |
| Gene ID - Rat | ENSRNOG00000037871 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SFXN5 pAb (ATL-HPA056866) | |
| Datasheet | Anti SFXN5 pAb (ATL-HPA056866) Datasheet (External Link) |
| Vendor Page | Anti SFXN5 pAb (ATL-HPA056866) at Atlas Antibodies |
| Documents & Links for Anti SFXN5 pAb (ATL-HPA056866) | |
| Datasheet | Anti SFXN5 pAb (ATL-HPA056866) Datasheet (External Link) |
| Vendor Page | Anti SFXN5 pAb (ATL-HPA056866) |