Anti SFXN5 pAb (ATL-HPA056866)

Atlas Antibodies

Catalog No.:
ATL-HPA056866-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sideroflexin 5
Gene Name: SFXN5
Alternative Gene Name: BBG-TCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033720: 100%, ENSRNOG00000037871: 100%
Entrez Gene ID: 94097
Uniprot ID: Q8TD22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLREAVQLLEDYKHGTLRPGVTNEQLWSAQKIKQAILHPDTNEKIFMPFRMS
Gene Sequence RLREAVQLLEDYKHGTLRPGVTNEQLWSAQKIKQAILHPDTNEKIFMPFRMS
Gene ID - Mouse ENSMUSG00000033720
Gene ID - Rat ENSRNOG00000037871
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SFXN5 pAb (ATL-HPA056866)
Datasheet Anti SFXN5 pAb (ATL-HPA056866) Datasheet (External Link)
Vendor Page Anti SFXN5 pAb (ATL-HPA056866) at Atlas Antibodies

Documents & Links for Anti SFXN5 pAb (ATL-HPA056866)
Datasheet Anti SFXN5 pAb (ATL-HPA056866) Datasheet (External Link)
Vendor Page Anti SFXN5 pAb (ATL-HPA056866)