Anti SFXN3 pAb (ATL-HPA048105)

Atlas Antibodies

Catalog No.:
ATL-HPA048105-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: sideroflexin 3
Gene Name: SFXN3
Alternative Gene Name: SFX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025212: 78%, ENSRNOG00000015442: 78%
Entrez Gene ID: 81855
Uniprot ID: Q9BWM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSIHISNLEPELRAQIHEQNPSVEVVYYNKGL
Gene Sequence SSIHISNLEPELRAQIHEQNPSVEVVYYNKGL
Gene ID - Mouse ENSMUSG00000025212
Gene ID - Rat ENSRNOG00000015442
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SFXN3 pAb (ATL-HPA048105)
Datasheet Anti SFXN3 pAb (ATL-HPA048105) Datasheet (External Link)
Vendor Page Anti SFXN3 pAb (ATL-HPA048105) at Atlas Antibodies

Documents & Links for Anti SFXN3 pAb (ATL-HPA048105)
Datasheet Anti SFXN3 pAb (ATL-HPA048105) Datasheet (External Link)
Vendor Page Anti SFXN3 pAb (ATL-HPA048105)