Anti SFXN3 pAb (ATL-HPA008028)

Atlas Antibodies

Catalog No.: ATL-HPA008028-25

Protein Description: sideroflexin 3
Gene Name: SFXN3
Alternative Gene Name: SFX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025212: 92%, ENSRNOG00000015442: 93%
Entrez Gene ID: 81855
Uniprot ID: Q9BWM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMN
• Gene Sequence: ESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMN
• Gene ID - Mouse: ENSMUSG00000025212
• Gene ID - Rat: ENSRNOG00000015442
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.