Anti SFXN2 pAb (ATL-HPA026834 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA026834-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sideroflexin 2
Gene Name: SFXN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025036: 83%, ENSRNOG00000018279: 51%
Entrez Gene ID: 118980
Uniprot ID: Q96NB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PMMRQQELIKGICVKDRNENEIGHSRRAAAIGITQ
Gene Sequence PMMRQQELIKGICVKDRNENEIGHSRRAAAIGITQ
Gene ID - Mouse ENSMUSG00000025036
Gene ID - Rat ENSRNOG00000018279
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SFXN2 pAb (ATL-HPA026834 w/enhanced validation)
Datasheet Anti SFXN2 pAb (ATL-HPA026834 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SFXN2 pAb (ATL-HPA026834 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SFXN2 pAb (ATL-HPA026834 w/enhanced validation)
Datasheet Anti SFXN2 pAb (ATL-HPA026834 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SFXN2 pAb (ATL-HPA026834 w/enhanced validation)