Anti SFXN1 pAb (ATL-HPA019543 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019543-25

Protein Description: sideroflexin 1
Gene Name: SFXN1
Alternative Gene Name: FLJ12876
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021474: 93%, ENSRNOG00000018279: 93%
Entrez Gene ID: 94081
Uniprot ID: Q9H9B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVPPGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQV
• Gene Sequence: SGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVPPGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQV
• Gene ID - Mouse: ENSMUSG00000021474
• Gene ID - Rat: ENSRNOG00000018279
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SFXN1 pAb (ATL-HPA019543 w/enhanced validation) – 2 Found

Laferrière, Florent; Claverol, Stéphane; Bezard, Erwan; De Giorgi, Francesca; Ichas, François. Similar neuronal imprint and no cross-seeded fibrils in α-synuclein aggregates from MSA and Parkinson's disease. Npj Parkinson's Disease. 2022;8(1):10. 

Tifoun, Nesrine; Bekhouche, Mourad; De Las Heras, José M; Guillaume, Arnaud; Bouleau, Sylvina; Guénal, Isabelle; Mignotte, Bernard; Le Floch, Nathalie. A High-Throughput Search for SFXN1 Physical Partners Led to the Identification of ATAD3, HSD10 and TIM50. Biology. 2022;11(9)