Anti SFTPB pAb (ATL-HPA034820 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034820-25

Protein Description: surfactant protein B
Gene Name: SFTPB
Alternative Gene Name: SFTP3, SP-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103879: 74%, ENSRNOG00000010761: 77%
Entrez Gene ID: 6439
Uniprot ID: P07988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFP
• Gene Sequence: AWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFP
• Gene ID - Mouse: ENSMUSG00000103879
• Gene ID - Rat: ENSRNOG00000010761
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SFTPB pAb (ATL-HPA034820 w/enhanced validation) – 2 Found

Rao, Wei; Niroula, Suchan; Wang, Shan; Vincent, Matthew; McKeon, Frank; Xian, Wa. Protocol for Cloning Epithelial Stem Cell Variants from Human Lung. Star Protocols. 2020;1(2) 

Rao, Wei; Wang, Shan; Duleba, Marcin; Niroula, Suchan; Goller, Kristina; Xie, Jingzhong; Mahalingam, Rajasekaran; Neupane, Rahul; Liew, Audrey-Ann; Vincent, Matthew; Okuda, Kenichi; O'Neal, Wanda K; Boucher, Richard C; Dickey, Burton F; Wechsler, Michael E; Ibrahim, Omar; Engelhardt, John F; Mertens, Tinne C J; Wang, Wei; Jyothula, Soma S K; Crum, Christopher P; Karmouty-Quintana, Harry; Parekh, Kalpaj R; Metersky, Mark L; McKeon, Frank D; Xian, Wa. Regenerative Metaplastic Clones in COPD Lung Drive Inflammation and Fibrosis. Cell. 2020;181(4):848-864.e18.