Anti SFT2D1 pAb (ATL-HPA014677)

Atlas Antibodies

Catalog No.: ATL-HPA014677-25

Protein Description: SFT2 domain containing 1
Gene Name: SFT2D1
Alternative Gene Name: C6orf83, MGC19825, pRGR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073468: 100%, ENSRNOG00000024140: 100%
Entrez Gene ID: 113402
Uniprot ID: Q8WV19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRL
• Gene Sequence: MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRL
• Gene ID - Mouse: ENSMUSG00000073468
• Gene ID - Rat: ENSRNOG00000024140
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.