Anti SFSWAP pAb (ATL-HPA040063)

Atlas Antibodies

Catalog No.:
ATL-HPA040063-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: splicing factor, suppressor of white-apricot family
Gene Name: SFSWAP
Alternative Gene Name: SFRS8, SWAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029439: 90%, ENSRNOG00000000931: 91%
Entrez Gene ID: 6433
Uniprot ID: Q12872
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVSSDNEDDDD
Gene Sequence VELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVSSDNEDDDD
Gene ID - Mouse ENSMUSG00000029439
Gene ID - Rat ENSRNOG00000000931
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SFSWAP pAb (ATL-HPA040063)
Datasheet Anti SFSWAP pAb (ATL-HPA040063) Datasheet (External Link)
Vendor Page Anti SFSWAP pAb (ATL-HPA040063) at Atlas Antibodies

Documents & Links for Anti SFSWAP pAb (ATL-HPA040063)
Datasheet Anti SFSWAP pAb (ATL-HPA040063) Datasheet (External Link)
Vendor Page Anti SFSWAP pAb (ATL-HPA040063)