Anti SFSWAP pAb (ATL-HPA039362)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039362-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SFSWAP
Alternative Gene Name: SFRS8, SWAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029439: 90%, ENSRNOG00000000931: 90%
Entrez Gene ID: 6433
Uniprot ID: Q12872
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NYLHPSLFASKKCNRLEELMKPLKVVDPDHPLAALVRKAQADSSTPTPHNADGAPVQPSQVEYTADSTVAAMYYSYYMLPDGTYCLAPPPPGIDVTTY |
| Gene Sequence | NYLHPSLFASKKCNRLEELMKPLKVVDPDHPLAALVRKAQADSSTPTPHNADGAPVQPSQVEYTADSTVAAMYYSYYMLPDGTYCLAPPPPGIDVTTY |
| Gene ID - Mouse | ENSMUSG00000029439 |
| Gene ID - Rat | ENSRNOG00000000931 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SFSWAP pAb (ATL-HPA039362) | |
| Datasheet | Anti SFSWAP pAb (ATL-HPA039362) Datasheet (External Link) |
| Vendor Page | Anti SFSWAP pAb (ATL-HPA039362) at Atlas Antibodies |
| Documents & Links for Anti SFSWAP pAb (ATL-HPA039362) | |
| Datasheet | Anti SFSWAP pAb (ATL-HPA039362) Datasheet (External Link) |
| Vendor Page | Anti SFSWAP pAb (ATL-HPA039362) |