Anti SFPQ pAb (ATL-HPA047513 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA047513-25
  • Immunohistochemical staining of human endometrium, kidney, lymphoid tissues and testis using Anti-SFPQ antibody HPA047513 (A) shows similar protein distribution across tissues to independent antibody HPA054689 (B).
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SFPQ antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: splicing factor proline/glutamine-rich
Gene Name: SFPQ
Alternative Gene Name: PPP1R140, PSF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028820: 100%, ENSRNOG00000058461: 100%
Entrez Gene ID: 6421
Uniprot ID: P23246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNK
Gene Sequence IGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNK
Gene ID - Mouse ENSMUSG00000028820
Gene ID - Rat ENSRNOG00000058461
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SFPQ pAb (ATL-HPA047513 w/enhanced validation)
Datasheet Anti SFPQ pAb (ATL-HPA047513 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SFPQ pAb (ATL-HPA047513 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SFPQ pAb (ATL-HPA047513 w/enhanced validation)
Datasheet Anti SFPQ pAb (ATL-HPA047513 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SFPQ pAb (ATL-HPA047513 w/enhanced validation)