Anti SFMBT1 pAb (ATL-HPA064564)

Atlas Antibodies

Catalog No.:
ATL-HPA064564-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Scm-like with four mbt domains 1
Gene Name: SFMBT1
Alternative Gene Name: DKFZp434L243, RU1, SFMBT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006527: 94%, ENSRNOG00000016645: 94%
Entrez Gene ID: 51460
Uniprot ID: Q9UHJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YTHYYGKKKNKRIGRPPGGHSNLACALKKASKRRKRRKNVFVHKKKRSSASVDNTPAGSPQGS
Gene Sequence YTHYYGKKKNKRIGRPPGGHSNLACALKKASKRRKRRKNVFVHKKKRSSASVDNTPAGSPQGS
Gene ID - Mouse ENSMUSG00000006527
Gene ID - Rat ENSRNOG00000016645
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SFMBT1 pAb (ATL-HPA064564)
Datasheet Anti SFMBT1 pAb (ATL-HPA064564) Datasheet (External Link)
Vendor Page Anti SFMBT1 pAb (ATL-HPA064564) at Atlas Antibodies

Documents & Links for Anti SFMBT1 pAb (ATL-HPA064564)
Datasheet Anti SFMBT1 pAb (ATL-HPA064564) Datasheet (External Link)
Vendor Page Anti SFMBT1 pAb (ATL-HPA064564)
Citations for Anti SFMBT1 pAb (ATL-HPA064564) – 1 Found
Liu, Xijuan; Simon, Jeremy M; Xie, Haibiao; Hu, Lianxin; Wang, Jun; Zurlo, Giada; Fan, Cheng; Ptacek, Travis S; Herring, Laura; Tan, Xianming; Li, Mingjie; Baldwin, Albert S; Kim, William Y; Wu, Tao; Kirschner, Marc W; Gong, Kan; Zhang, Qing. Genome-wide Screening Identifies SFMBT1 as an Oncogenic Driver in Cancer with VHL Loss. Molecular Cell. 2020;77(6):1294-1306.e5.  PubMed