Anti SF3B5 pAb (ATL-HPA054408)

Atlas Antibodies

Catalog No.: ATL-HPA054408-100

Protein Description: splicing factor 3b, subunit 5, 10kDa
Gene Name: SF3B5
Alternative Gene Name: MGC3133, SF3b10, Ysf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078348: 99%, ENSRNOG00000014908: 99%
Entrez Gene ID: 83443
Uniprot ID: Q9BWJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN
• Gene Sequence: DRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN
• Gene ID - Mouse: ENSMUSG00000078348
• Gene ID - Rat: ENSRNOG00000014908
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.