Anti SF3B4 pAb (ATL-HPA064660)

Atlas Antibodies

Catalog No.:
ATL-HPA064660-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: splicing factor 3b, subunit 4, 49kDa
Gene Name: SF3B4
Alternative Gene Name: Hsh49, SAP49, SF3b49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068856: 100%, ENSRNOG00000021181: 100%
Entrez Gene ID: 10262
Uniprot ID: Q15427
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNP
Gene Sequence VSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNP
Gene ID - Mouse ENSMUSG00000068856
Gene ID - Rat ENSRNOG00000021181
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SF3B4 pAb (ATL-HPA064660)
Datasheet Anti SF3B4 pAb (ATL-HPA064660) Datasheet (External Link)
Vendor Page Anti SF3B4 pAb (ATL-HPA064660) at Atlas Antibodies

Documents & Links for Anti SF3B4 pAb (ATL-HPA064660)
Datasheet Anti SF3B4 pAb (ATL-HPA064660) Datasheet (External Link)
Vendor Page Anti SF3B4 pAb (ATL-HPA064660)