Anti SF3B4 pAb (ATL-HPA064660)

Atlas Antibodies

Catalog No.: ATL-HPA064660-100

Protein Description: splicing factor 3b, subunit 4, 49kDa
Gene Name: SF3B4
Alternative Gene Name: Hsh49, SAP49, SF3b49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068856: 100%, ENSRNOG00000021181: 100%
Entrez Gene ID: 10262
Uniprot ID: Q15427
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNP
• Gene Sequence: VSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNP
• Gene ID - Mouse: ENSMUSG00000068856
• Gene ID - Rat: ENSRNOG00000021181
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.