Anti SF3B2 pAb (ATL-HPA045028)

Atlas Antibodies

Catalog No.:
ATL-HPA045028-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: splicing factor 3b, subunit 2, 145kDa
Gene Name: SF3B2
Alternative Gene Name: Cus1, SAP145, SF3b1, SF3b145
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024853: 100%, ENSRNOG00000020412: 100%
Entrez Gene ID: 10992
Uniprot ID: Q13435
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFK
Gene Sequence MSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFK
Gene ID - Mouse ENSMUSG00000024853
Gene ID - Rat ENSRNOG00000020412
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SF3B2 pAb (ATL-HPA045028)
Datasheet Anti SF3B2 pAb (ATL-HPA045028) Datasheet (External Link)
Vendor Page Anti SF3B2 pAb (ATL-HPA045028) at Atlas Antibodies

Documents & Links for Anti SF3B2 pAb (ATL-HPA045028)
Datasheet Anti SF3B2 pAb (ATL-HPA045028) Datasheet (External Link)
Vendor Page Anti SF3B2 pAb (ATL-HPA045028)