Anti SETMAR pAb (ATL-HPA057999)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057999-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SETMAR
Alternative Gene Name: metnase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034639: 42%, ENSRNOG00000006806: 47%
Entrez Gene ID: 6419
Uniprot ID: Q53H47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTL |
Gene Sequence | ELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTL |
Gene ID - Mouse | ENSMUSG00000034639 |
Gene ID - Rat | ENSRNOG00000006806 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SETMAR pAb (ATL-HPA057999) | |
Datasheet | Anti SETMAR pAb (ATL-HPA057999) Datasheet (External Link) |
Vendor Page | Anti SETMAR pAb (ATL-HPA057999) at Atlas Antibodies |
Documents & Links for Anti SETMAR pAb (ATL-HPA057999) | |
Datasheet | Anti SETMAR pAb (ATL-HPA057999) Datasheet (External Link) |
Vendor Page | Anti SETMAR pAb (ATL-HPA057999) |