Anti SETD7 pAb (ATL-HPA058111)

Atlas Antibodies

SKU: ATL-HPA058111-25

• 
• 
• 

Protein Description: SET domain containing (lysine methyltransferase) 7
Gene Name: SETD7
Alternative Gene Name: KIAA1717, KMT7, SET7, SET7/9, Set9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037111: 96%, ENSRNOG00000013045: 97%
Entrez Gene ID: 80854
Uniprot ID: Q8WTS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHS
• Gene Sequence: TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHS
• Gene ID - Mouse: ENSMUSG00000037111
• Gene ID - Rat: ENSRNOG00000013045
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.