Anti SETD7 pAb (ATL-HPA058111)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058111-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SETD7
Alternative Gene Name: KIAA1717, KMT7, SET7, SET7/9, Set9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037111: 96%, ENSRNOG00000013045: 97%
Entrez Gene ID: 80854
Uniprot ID: Q8WTS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHS |
| Gene Sequence | TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHS |
| Gene ID - Mouse | ENSMUSG00000037111 |
| Gene ID - Rat | ENSRNOG00000013045 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SETD7 pAb (ATL-HPA058111) | |
| Datasheet | Anti SETD7 pAb (ATL-HPA058111) Datasheet (External Link) |
| Vendor Page | Anti SETD7 pAb (ATL-HPA058111) at Atlas Antibodies |
| Documents & Links for Anti SETD7 pAb (ATL-HPA058111) | |
| Datasheet | Anti SETD7 pAb (ATL-HPA058111) Datasheet (External Link) |
| Vendor Page | Anti SETD7 pAb (ATL-HPA058111) |