Anti SETD6 pAb (ATL-HPA053546)

Atlas Antibodies

Catalog No.:
ATL-HPA053546-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SET domain containing 6
Gene Name: SETD6
Alternative Gene Name: FLJ21148
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031671: 86%, ENSRNOG00000012447: 85%
Entrez Gene ID: 79918
Uniprot ID: Q8TBK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VATQPIPKGHEIFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVG
Gene Sequence VATQPIPKGHEIFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVG
Gene ID - Mouse ENSMUSG00000031671
Gene ID - Rat ENSRNOG00000012447
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SETD6 pAb (ATL-HPA053546)
Datasheet Anti SETD6 pAb (ATL-HPA053546) Datasheet (External Link)
Vendor Page Anti SETD6 pAb (ATL-HPA053546) at Atlas Antibodies

Documents & Links for Anti SETD6 pAb (ATL-HPA053546)
Datasheet Anti SETD6 pAb (ATL-HPA053546) Datasheet (External Link)
Vendor Page Anti SETD6 pAb (ATL-HPA053546)