Anti SETD3 pAb (ATL-HPA003591)

Atlas Antibodies

Catalog No.: ATL-HPA003591-25

Protein Description: SET domain containing 3
Gene Name: SETD3
Alternative Gene Name: C14orf154, FLJ23027
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056770: 97%, ENSRNOG00000046275: 98%
Entrez Gene ID: 84193
Uniprot ID: Q86TU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSR
• Gene Sequence: ERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSR
• Gene ID - Mouse: ENSMUSG00000056770
• Gene ID - Rat: ENSRNOG00000046275
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SETD3 pAb (ATL-HPA003591) – 1 Found

Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Rönnerman, Elisabeth Werner; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Validation of Novel Prognostic Biomarkers for Early-Stage Clear-Cell, Endometrioid and Mucinous Ovarian Carcinomas Using Immunohistochemistry. Frontiers In Oncology. 10( 32133296):162.