Anti SETD1B pAb (ATL-HPA059412)

Atlas Antibodies

Catalog No.:
ATL-HPA059412-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SET domain containing 1B
Gene Name: SETD1B
Alternative Gene Name: KIAA1076, KMT2G, Set1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038384: 97%, ENSRNOG00000001337: 97%
Entrez Gene ID: 23067
Uniprot ID: Q9UPS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLQFVNLPPYRGPFSLSNSGPGRGQHWPPLPKFDPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMK
Gene Sequence GLQFVNLPPYRGPFSLSNSGPGRGQHWPPLPKFDPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMK
Gene ID - Mouse ENSMUSG00000038384
Gene ID - Rat ENSRNOG00000001337
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SETD1B pAb (ATL-HPA059412)
Datasheet Anti SETD1B pAb (ATL-HPA059412) Datasheet (External Link)
Vendor Page Anti SETD1B pAb (ATL-HPA059412) at Atlas Antibodies

Documents & Links for Anti SETD1B pAb (ATL-HPA059412)
Datasheet Anti SETD1B pAb (ATL-HPA059412) Datasheet (External Link)
Vendor Page Anti SETD1B pAb (ATL-HPA059412)