Anti SETD1B pAb (ATL-HPA059412)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059412-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SETD1B
Alternative Gene Name: KIAA1076, KMT2G, Set1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038384: 97%, ENSRNOG00000001337: 97%
Entrez Gene ID: 23067
Uniprot ID: Q9UPS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLQFVNLPPYRGPFSLSNSGPGRGQHWPPLPKFDPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMK |
| Gene Sequence | GLQFVNLPPYRGPFSLSNSGPGRGQHWPPLPKFDPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMK |
| Gene ID - Mouse | ENSMUSG00000038384 |
| Gene ID - Rat | ENSRNOG00000001337 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SETD1B pAb (ATL-HPA059412) | |
| Datasheet | Anti SETD1B pAb (ATL-HPA059412) Datasheet (External Link) |
| Vendor Page | Anti SETD1B pAb (ATL-HPA059412) at Atlas Antibodies |
| Documents & Links for Anti SETD1B pAb (ATL-HPA059412) | |
| Datasheet | Anti SETD1B pAb (ATL-HPA059412) Datasheet (External Link) |
| Vendor Page | Anti SETD1B pAb (ATL-HPA059412) |