Anti SET pAb (ATL-HPA063683)

Atlas Antibodies

Catalog No.:
ATL-HPA063683-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: SET nuclear proto-oncogene
Gene Name: SET
Alternative Gene Name: 2PP2A, IPP2A2, PHAPII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054766: 77%, ENSRNOG00000025892: 77%
Entrez Gene ID: 6418
Uniprot ID: Q01105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEID
Gene Sequence MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEID
Gene ID - Mouse ENSMUSG00000054766
Gene ID - Rat ENSRNOG00000025892
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SET pAb (ATL-HPA063683)
Datasheet Anti SET pAb (ATL-HPA063683) Datasheet (External Link)
Vendor Page Anti SET pAb (ATL-HPA063683) at Atlas Antibodies

Documents & Links for Anti SET pAb (ATL-HPA063683)
Datasheet Anti SET pAb (ATL-HPA063683) Datasheet (External Link)
Vendor Page Anti SET pAb (ATL-HPA063683)