Anti SET pAb (ATL-HPA063683)

Atlas Antibodies

Catalog No.: ATL-HPA063683-25

Protein Description: SET nuclear proto-oncogene
Gene Name: SET
Alternative Gene Name: 2PP2A, IPP2A2, PHAPII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054766: 77%, ENSRNOG00000025892: 77%
Entrez Gene ID: 6418
Uniprot ID: Q01105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEID
• Gene Sequence: MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEID
• Gene ID - Mouse: ENSMUSG00000054766
• Gene ID - Rat: ENSRNOG00000025892
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.