Anti SESTD1 pAb (ATL-HPA058236)

Atlas Antibodies

SKU:
ATL-HPA058236-25
  • Immunofluorescent staining of human cell line AF22 shows localization to intermediate filaments.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SEC14 and spectrin domain containing 1
Gene Name: SESTD1
Alternative Gene Name: DKFZp434O0515, Solo
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042272: 100%, ENSRNOG00000012603: 100%
Entrez Gene ID: 91404
Uniprot ID: Q86VW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHSEWFAVYVEL
Gene Sequence PQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHSEWFAVYVEL
Gene ID - Mouse ENSMUSG00000042272
Gene ID - Rat ENSRNOG00000012603
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SESTD1 pAb (ATL-HPA058236)
Datasheet Anti SESTD1 pAb (ATL-HPA058236) Datasheet (External Link)
Vendor Page Anti SESTD1 pAb (ATL-HPA058236) at Atlas Antibodies

Documents & Links for Anti SESTD1 pAb (ATL-HPA058236)
Datasheet Anti SESTD1 pAb (ATL-HPA058236) Datasheet (External Link)
Vendor Page Anti SESTD1 pAb (ATL-HPA058236)