Anti SESTD1 pAb (ATL-HPA058236)

Atlas Antibodies

Catalog No.: ATL-HPA058236-25

Protein Description: SEC14 and spectrin domain containing 1
Gene Name: SESTD1
Alternative Gene Name: DKFZp434O0515, Solo
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042272: 100%, ENSRNOG00000012603: 100%
Entrez Gene ID: 91404
Uniprot ID: Q86VW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHSEWFAVYVEL
• Gene Sequence: PQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHSEWFAVYVEL
• Gene ID - Mouse: ENSMUSG00000042272
• Gene ID - Rat: ENSRNOG00000012603
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.