Anti SESN1 pAb (ATL-HPA073659)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073659-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SESN1
Alternative Gene Name: PA26, SEST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038332: 95%, ENSRNOG00000000302: 93%
Entrez Gene ID: 27244
Uniprot ID: Q9Y6P5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYC |
| Gene Sequence | ASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYC |
| Gene ID - Mouse | ENSMUSG00000038332 |
| Gene ID - Rat | ENSRNOG00000000302 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SESN1 pAb (ATL-HPA073659) | |
| Datasheet | Anti SESN1 pAb (ATL-HPA073659) Datasheet (External Link) |
| Vendor Page | Anti SESN1 pAb (ATL-HPA073659) at Atlas Antibodies |
| Documents & Links for Anti SESN1 pAb (ATL-HPA073659) | |
| Datasheet | Anti SESN1 pAb (ATL-HPA073659) Datasheet (External Link) |
| Vendor Page | Anti SESN1 pAb (ATL-HPA073659) |