Anti SESN1 pAb (ATL-HPA073659)

Atlas Antibodies

Catalog No.:
ATL-HPA073659-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sestrin 1
Gene Name: SESN1
Alternative Gene Name: PA26, SEST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038332: 95%, ENSRNOG00000000302: 93%
Entrez Gene ID: 27244
Uniprot ID: Q9Y6P5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYC
Gene Sequence ASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYC
Gene ID - Mouse ENSMUSG00000038332
Gene ID - Rat ENSRNOG00000000302
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SESN1 pAb (ATL-HPA073659)
Datasheet Anti SESN1 pAb (ATL-HPA073659) Datasheet (External Link)
Vendor Page Anti SESN1 pAb (ATL-HPA073659) at Atlas Antibodies

Documents & Links for Anti SESN1 pAb (ATL-HPA073659)
Datasheet Anti SESN1 pAb (ATL-HPA073659) Datasheet (External Link)
Vendor Page Anti SESN1 pAb (ATL-HPA073659)