Anti SERTAD4 pAb (ATL-HPA028514)

Atlas Antibodies

Catalog No.:
ATL-HPA028514-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SERTA domain containing 4
Gene Name: SERTAD4
Alternative Gene Name: DJ667H12.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016262: 86%, ENSRNOG00000060773: 84%
Entrez Gene ID: 56256
Uniprot ID: Q9NUC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLKFIDDPEVYLRRSVLINNLMKRIHGEIIMQNNWCFPACSFNGTSAQEWFMAQDCPYRKRPRMAKEEC
Gene Sequence KLKFIDDPEVYLRRSVLINNLMKRIHGEIIMQNNWCFPACSFNGTSAQEWFMAQDCPYRKRPRMAKEEC
Gene ID - Mouse ENSMUSG00000016262
Gene ID - Rat ENSRNOG00000060773
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SERTAD4 pAb (ATL-HPA028514)
Datasheet Anti SERTAD4 pAb (ATL-HPA028514) Datasheet (External Link)
Vendor Page Anti SERTAD4 pAb (ATL-HPA028514) at Atlas Antibodies

Documents & Links for Anti SERTAD4 pAb (ATL-HPA028514)
Datasheet Anti SERTAD4 pAb (ATL-HPA028514) Datasheet (External Link)
Vendor Page Anti SERTAD4 pAb (ATL-HPA028514)