Anti SERTAD3 pAb (ATL-HPA068262)

Atlas Antibodies

Catalog No.:
ATL-HPA068262-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SERTA domain containing 3
Gene Name: SERTAD3
Alternative Gene Name: RBT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055200: 79%, ENSRNOG00000037690: 76%
Entrez Gene ID: 29946
Uniprot ID: Q9UJW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATIGSILRELDTSMDGTEPPQNPVTPLGLQNEVPPQPDPVFLEALSSRYLGDSGLDDFFLDIDTSAV
Gene Sequence ATIGSILRELDTSMDGTEPPQNPVTPLGLQNEVPPQPDPVFLEALSSRYLGDSGLDDFFLDIDTSAV
Gene ID - Mouse ENSMUSG00000055200
Gene ID - Rat ENSRNOG00000037690
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SERTAD3 pAb (ATL-HPA068262)
Datasheet Anti SERTAD3 pAb (ATL-HPA068262) Datasheet (External Link)
Vendor Page Anti SERTAD3 pAb (ATL-HPA068262) at Atlas Antibodies

Documents & Links for Anti SERTAD3 pAb (ATL-HPA068262)
Datasheet Anti SERTAD3 pAb (ATL-HPA068262) Datasheet (External Link)
Vendor Page Anti SERTAD3 pAb (ATL-HPA068262)