Anti SERTAD1 pAb (ATL-HPA063323)

Atlas Antibodies

Catalog No.:
ATL-HPA063323-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SERTA domain containing 1
Gene Name: SERTAD1
Alternative Gene Name: SEI1, TRIP-Br1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008384: 91%, ENSRNOG00000024363: 89%
Entrez Gene ID: 29950
Uniprot ID: Q9UHV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSMYDNELWAPASEGLKPGPEDGPGKEEAPELDEAELDYLMDVLVGTQALERP
Gene Sequence TSMYDNELWAPASEGLKPGPEDGPGKEEAPELDEAELDYLMDVLVGTQALERP
Gene ID - Mouse ENSMUSG00000008384
Gene ID - Rat ENSRNOG00000024363
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SERTAD1 pAb (ATL-HPA063323)
Datasheet Anti SERTAD1 pAb (ATL-HPA063323) Datasheet (External Link)
Vendor Page Anti SERTAD1 pAb (ATL-HPA063323) at Atlas Antibodies

Documents & Links for Anti SERTAD1 pAb (ATL-HPA063323)
Datasheet Anti SERTAD1 pAb (ATL-HPA063323) Datasheet (External Link)
Vendor Page Anti SERTAD1 pAb (ATL-HPA063323)