Anti SERTAD1 pAb (ATL-HPA063323)

Atlas Antibodies

Catalog No.: ATL-HPA063323-25

Protein Description: SERTA domain containing 1
Gene Name: SERTAD1
Alternative Gene Name: SEI1, TRIP-Br1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008384: 91%, ENSRNOG00000024363: 89%
Entrez Gene ID: 29950
Uniprot ID: Q9UHV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSMYDNELWAPASEGLKPGPEDGPGKEEAPELDEAELDYLMDVLVGTQALERP
• Gene Sequence: TSMYDNELWAPASEGLKPGPEDGPGKEEAPELDEAELDYLMDVLVGTQALERP
• Gene ID - Mouse: ENSMUSG00000008384
• Gene ID - Rat: ENSRNOG00000024363
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.